Unique_ID Origin_ID Sequence Activity Source Structure Hemolysis Reference Length Stereo FPDB00014 AP00176|||AP00176|||Human defensin 1|||DRAMP03591|||AP00176|||DRAMP03591|||AP00176|||DRAMP03591 ACYCRIPACIAGERRYGTCIYQGRLWAFCC Chemotactic||Anti-MRSA||Anti-toxin||Enzyme inhibitor||anti-sepsis||Wound healing||Anticancer||Anti-Killed C. difficile. Active against L. monocytogenes, activity value is MIC = 39.7 ug/ml||Anti-S.epidermis, activity value is MIC = 2.2 ug/ml||Anti-S. aureus or MRSA, activity value is MIC = 5.2||Anti-and S. maltophilia, activity value is MIC = 1.8||Anti-Gram+ & Gram-||Antiviral||Antifungal||Antiparasitic||Anti-HIV||T. cruzi||Antimicrobial||Antibacterial||Anti-Gram+||Anti-Gram-||Antiviral(SARS-CoV-2) neutrophils; natural killer cells, monocytes; airway, saliva; Homo sapiens|||neutrophils; natural killer cells, monocytes; airway, saliva; Homo sapiens|||Homo sapiens [Human]|||Homo sapiens (Human)|||neutrophils; natural killer cells, monocytes; airway, saliva; Homo sapiens|||Homo sapiens (Human)|||neutrophils; natural killer cells, monocytes; airway, saliva; Homo sapiens|||Homo sapiens (Human) Beta||Beta strand Strong hemolytic activity (100% hemolysis at 5 μM)|||No hemolysis information or data found in the reference(s) presented in this entry "J Clin Invest. 1985 Oct;76(4):1436-9. Pub-Med.|||Selsted ME, Harwig SS, Ganz T, Schilling JW, Lehrer RI1985 J Clin Invest. 1985 Oct;76(4):1436-9. Pub-Med.||Peschel et al., 2001||Buck et al., 2006||Xu et al., 2021||Li et al., 2020||Charp et al., 1988|||1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.||Peschel et al., 2001||Buck et al., 2006||Xu et al., 2021||Li et al., 2020||Charp et al., 1988|||J Clin Invest. 1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.||Peschel et al., 2001||Buck et al., 2006||Xu et al., 2021||Li et al., 2020||Charp et al., 1988|||J Clin Invest. 1985 Oct;76(4):1436-9. Pub-Med.|||1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121||Peschel et al., 2001||Buck et al., 2006||Xu et al., 2021||Li et al., 2020||Charp et al., 1988|||Comparative Study J Clin Invest . 1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.||Peschel et al., 2001||Buck et al., 2006||Xu et al., 2021||Li et al., 2020||Charp et al., 1988|||17635867|||Viruses. 2021 Jun 26;13(7):1246.|||J Clin Invest. 1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.||Peschel et al., 2001||Buck et al., 2006||Xu et al., 2021||Li et al., 2020||Charp et al., 1988|||Viruses. 2021 Jun 26;13(7):1246.Proteomics. 2009 Mar;9(5):1364-1373.Antimicrob Agents Chemother. 2005 Jan;49(1):269-275.Proc Natl Acad Sci U S A. 2004 May 11;101(19):7363-8.|||1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.||Peschel et al., 2001||Buck et al., 2006||Xu et al., 2021||Li et al., 2020||Charp et al., 1988|||Viruses. 2021 Jun 26;13(7):1246." 30 FPDB00015 AP00177|||AP00177|||Human neutrophil peptide-2|||DRAMP03592|||AP00177|||DRAMP03592|||AP00177|||DRAMP03592 CYCRIPACIAGERRYGTCIYQGRLWAFCC Anti-Gram+ & Gram-||Antiviral||Antifungal||Anti-HIV||Chemotactic||Anti-toxin||Enzyme inhibitor||Anticancer||Anti-P. aeruginosa CIP 76.110, activity value is MIC = 1 ug/ml||Anti-S. aureus ATCC 29213 and S. epidermidis CIP 68.21, activity value is MIC = 0.5 ug/ml||Anti-E. coli ATCC 8739 ( v, activity value is LD50 = 3.5||Anti-E. coli ATCC 25922 ( v, activity value is LD50 = 3.5||Anti-E. aerogenes ATCC 13048 ( v, activity value is LD50 = 16||Anti-S. aureus ATCC 25923 ( v, activity value is LD50 = 4.2||Anti-S. aureus ATCC 29213 ( v, activity value is LD50 = 2.4||Anti-B. cereus ATCC 10876 ( v, activity value is LD50 = 0.22||Antimicrobial||Antibacterial||Anti-Gram+||Anti-Gram-||Antiviral(SARS-CoV-2) neutrophils; natural killer cells, monocytes; sairway, aliva; Homo sapiens|||neutrophils; natural killer cells, monocytes; sairway, aliva; Homo sapiens|||Homo sapiens [Human]|||Homo sapiens (Human)|||neutrophils; natural killer cells, monocytes; sairway, aliva; Homo sapiens|||Homo sapiens (Human)|||neutrophils; natural killer cells, monocytes; sairway, aliva; Homo sapiens|||Homo sapiens (Human) Beta||Beta strand Strong hemolytic activity (100% hemolysis at 5 μM)|||No hemolysis information or data found in the reference(s) presented in this entry "J Clin Invest. 1985 Oct;76(4):1436-9. Pub-Med.|||Selsted ME, Harwig SS, Ganz T, Schilling JW, Lehrer RI1985 J Clin Invest. 1985 Oct;76(4):1436-9. Pub-Med.|||1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.|||J Clin Invest. 1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.|||Comparative Study J Clin Invest . 1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.|||15616305|||Viruses. 2021 Jun 26;13(7):1246.|||J Clin Invest. 1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.|||Viruses. 2021 Jun 26;13(7):1246.Proteomics. 2009 Mar;9(5):1364-1373.Antimicrob Agents Chemother. 2005 Jan;49(1):269-275.Proc Natl Acad Sci U S A. 2004 May 11;101(19):7363-8.|||1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.|||Viruses. 2021 Jun 26;13(7):1246." 29 FPDB00016 AP00178|||AP00178|||HNP3|||DRAMP03593|||AP00178|||DRAMP03593|||AP00178|||DRAMP03593 DCYCRIPACIAGERRYGTCIYQGRLWAFCC Anti-Gram+ & Gram-||Antiviral||Antifungal||Anti-HIV||Chemotactic||Anti-toxin||Enzyme inhibitor||Anticancer||Anti-P. aeruginosa CIP 76.110, activity value is MIC = 1 ug/ml||Anti-S. aureus ATCC 29213 and S. epidermidis CIP 68.21, activity value is MIC = 0.5 ug/ml||Anti-E. coli MG1655, activity value is MBC = 20 uM||Antimicrobial||Antibacterial||Anti-Gram+||Anti-Gram-||Antiviral(SARS-CoV-2)||Antiviral(SARS-CoV-3) neutrophils; natural killer cells, monocytes; airway, saliva; Homo sapiens|||neutrophils; natural killer cells, monocytes; airway, saliva; Homo sapiens|||Homo sapiens [Human]|||Homo sapiens (Human)|||neutrophils; natural killer cells, monocytes; airway, saliva; Homo sapiens|||Homo sapiens (Human)|||neutrophils; natural killer cells, monocytes; airway, saliva; Homo sapiens|||Homo sapiens (Human) Beta||Beta strand Strong hemolytic activity (100% hemolysis at 5 μM)|||No hemolysis information or data found in the reference(s) presented in this entry "J Clin Invest. 1985 Oct;76(4):1436-9. Pub-Med.|||Selsted ME, Harwig SS, Ganz T, Schilling JW, Lehrer RI1985 J Clin Invest. 1985 Oct;76(4):1436-9. Pub-Med.||Buck et al., 2006||Xu et al., 2021||Cardot-Martin E et al. 2015|||1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.||Buck et al., 2006||Xu et al., 2021||Cardot-Martin E et al. 2015|||J Clin Invest. 1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.||Buck et al., 2006||Xu et al., 2021||Cardot-Martin E et al. 2015|||Comparative Study J Clin Invest . 1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.||Buck et al., 2006||Xu et al., 2021||Cardot-Martin E et al. 2015|||28423004|||Viruses. 2021 Jun 26;13(7):1246.|||J Clin Invest. 1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.||Buck et al., 2006||Xu et al., 2021||Cardot-Martin E et al. 2015|||Viruses. 2021 Jun 26;13(7):1246.J Clin Invest. 1985 Oct;76(4):1436-1439.Antimicrob Agents Chemother. 2005 Jan;49(1):269-275.|||1985 Oct;76(4):1436-9. doi: 10.1172/JCI112121.||Buck et al., 2006||Xu et al., 2021||Cardot-Martin E et al. 2015|||Viruses. 2021 Jun 26;13(7):1246." 30 FPDB00017 AP00179|||DRAMP03594|||Neutrophil defensin 4|||AP00179|||DRAMP03594|||AP00179|||DRAMP03594 VCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRV Anti-Gram+ & Gram-||Antiviral||Antifungal||candidacidal||Anti-HIV||Anti-toxin||Active against E. coli||S. faecalis||and C. albicans.||Antimicrobial||Antibacterial||Anti-Gram+||Anti-Gram-||Antiviral(SARS-CoV-2)||Antiviral(SARS-CoV-4) Homo sapiens|||Homo sapiens (Human)|||Homo sapiens [Human]|||Homo sapiens|||Homo sapiens (Human)|||Homo sapiens|||Homo sapiens (Human) Beta||Beta strand No hemolysis information or data found in the reference(s) presented in this entry "J. Biol. Chem. 1989; 264:11200-11203. PubMed.|||1989 Jul 5;264(19):11200-3.|||J. Biol. Chem. 1989; 264:11200-11203.|||Comparative Study J Biol Chem . 1989 Jul 5;264(19):11200-3.|||Viruses. 2021 Jun 26;13(7):1246.|||2500436, 17088326, 30658057|||J. Biol. Chem. 1989; 264:11200-11203.|||Viruses. 2021 Jun 26;13(7):1246.Protein Sci. 2006 Dec;15(12):2749-2760.FEBS Lett. 2005 Jan 3;579(1):162-166.Antimicrob Agents Chemother. 2005 Jan;49(1):269-275.|||1989 Jul 5;264(19):11200-3.|||Viruses. 2021 Jun 26;13(7):1246." 33 FPDB00035 AP00283|||AP00283|||HBD3|||DRAMP03599|||AP00283 GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK Anti-Gram+ & Gram-||Antiviral||Antifungal||Anti-HIV||Chemotactic||Anti-MRSA||Anti-toxin||Anti-inflammatory||Channel inhibitors||Synergistic AMPs||Antibiofilm||Wound healing||Anticancer||Anti-An inducible human AMP. Active against E. coli DSM1103, activity value is MIC = 9.4 ug/ml||Anti-K. pneumoniae DSM681, activity value is MIC = 25 ug/ml||Anti-P. aeruginosa DSM1128, activity value is MIC = 18.75 ug/ml||Anti-S. aureus ATCC25923 or MRSA, activity value is MIC = 4.7 ug/ml||Anti-and S. pneumoniae DSM11865, activity value is MIC = 4.7 ug/ml||Anti-Escherichia coli DSM1103, activity value is MIC = 9.4 ug/ml||Anti-Klebsiella pneumoniae DSM681, activity value is MIC = 25 ug/ml||Anti-Pseudomonas aeruginosa DSM1128, activity value is MIC = 18.75 ug/ml||Anti-Staphylococcus aureus ATCC25923, activity value is MIC = 4.7 ug/ml||Anti-Streptococcus pneumoniae DSM11865, activity value is MIC = 4.7 ug/ml skin, tonsils, oral/saliva, colonic mucosa, Homo sapiens|||skin, tonsils, oral/saliva, colonic mucosa, Homo sapiens|||Synthetic construct|||Homo sapiens (Human)|||skin, tonsils, oral/saliva, colonic mucosa, Homo sapiens Combine Helix and Beta structure||Combine helix and strand structure "Because several cationic antimicrobial peptides have been reported to exhibit cytotoxic activity against eukaryotic cells, hBD-3 was also assayed for hemolytic activity against human erythrocytes. No significant hemolytic activity (,0.5%) was observed using concentrations of hBD-3 up to 500000 ug/ml at physiologic salt concentrations. However, significant hemolytic activity was seen at high hBD-3 concentrations in 10000 uM so-dium phosphate buffer containing 340000 uM sucrose|||Strong hemolytic activity (100% hemolysis at 10 μM)|||The document explicitly mentions the hemolytic values of human β-defensin 3 (hBD-3), with specific information as follows: 1. Under physiological saline conditions (phosphate-buffered saline, PBS): When the concentration of hBD-3 reaches as high as 500 µg/ml, the hemolysis rate of human red blood cells is still **<0.5%**, showing no significant hemolytic activity. 2. In a specific buffer (10000 µM sodium phosphate buffer containing 340,000 µM sucrose, pH 7.4): Significant hemolytic activity is only observed under high concentrations of hBD-3 (the specific concentration is not clearly marked as a fixed threshold and should be interpreted as far above physiologically relevant concentrations in the experimental context). These results indicate that hBD-3 exhibits almost no hemolytic toxicity to human red blood cells under physiological saline conditions and only shows hemolytic activity at non-physiological high concentrations and in specific buffer systems, reflecting good biocompatibility.|||The document explicitly mentions the hemolytic values of human β-defensin 3 (hBD-3), as follows: 1. Under physiological saline conditions (phosphate-buffered saline, PBS) Even when the concentration of hBD-3 reaches 500 µg/ml, the hemolysis rate of human red blood cells remains **<0.5%**, showing no significant hemolytic activity. 2. Hypotonic buffer containing 340,000 µM sucrose (10,000 µM sodium phosphate buffer, pH 7.4) Significant hemolytic activity is observed only at relatively high concentrations of hBD-3, but this condition is a non-physiological hypotonic environment that does not correspond to in vivo physiological conditions. These results indicate that hBD-3 exhibits no obvious cytotoxicity to eukaryotic cells (red blood cells) at physiologically relevant concentrations, and the risk of hemolysis is extremely low.|||At physiological salt concentrations, hBD-3 at concentrations up to 500 ug/ml did not exhibit significant hemolytic activity (<0.5%); however, in 10000 uM sodium phosphate buffer containing 340000 uM sucrose, hBD-3 at high concentrations had significant hemolytic activity (specific values not clear)." "J. Biol. Chem. 2001; 276:5707-5713|||Harder J, Bartels J, Christophers E, Schroeder JM.2001 J. Biol. Chem. 2001; 276:5707-5713||ref see AP1315|||J. Biol. Chem. 2001; 276:5707-5713||ref see AP1315|||J. Biol. Chem. 2001; 276:5707-5713|||ref see AP1315|||J Biol Chem. 2001 Feb 23;276(8):5707-5713.||Ref.11085990|||J. Biol. Chem. 2001; 276:5707-5713||ref see AP1315" 45 FPDB00045 AP00445|||AP00445|||RTD-1|||DRAMP02642|||AP00445|||DRAMP02642|||AP00445|||DRAMP02642 GFCRCLCRRGVCRCICTR Anti-Gram+ & Gram-||Antiviral||Antifungal||candidacidal||Anti-HIV||Anti-MRSA||Anti-toxin||Enzyme inhibitor||Active against S. aureus 502a or MRSA||L. monocytogenes||E. coli ML 35||S. typhimurium||C. albicans 16820||and C. neoformans. Theta-defensins are particularly important for antifungal activity of the granule extracts as alpha-defensins are poorly active (Tongaonkar P et al 2011 J Leuko Biol 89||283-90). It is also active against HIV-1. RTD-1 inhibits human Papillomavirus (hrHPV||nonenvelope DNA virus) infection through a mechanism involving capsid clustering that inhibits virions from binding to cell surface receptor complexes .||Antibacterial||Antimicrobial||Anti-Gram+||Anti-Gram- leukocytes, Rhesus Macaque (Macaca mulatta)|||leukocytes, Rhesus Macaque (Macaca mulatta)|||Macaca mulatta [Rhesus macaque]|||Macaca mulatta (Rhesus macaque)|||leukocytes, Rhesus Macaque (Macaca mulatta)|||Macaca mulatta (Rhesus macaque)|||leukocytes, Rhesus Macaque (Macaca mulatta)|||Macaca mulatta (Rhesus macaque) Beta||Beta strand (4 strands; 10 residues) Strong hemolytic activity (100% hemolysis at 5 μM)|||No hemolysis information or data found in the reference(s) presented in this entry Science. 1999 Oct 15;286(5439):498-502|||Science. 1999 Oct 15;286(5439):498-502||Skeate et al., 2020|||Science. 1999 Oct 15;286(5439):498-502||Skeate et al., 2020|||11675394|||Science. 1999 Oct 15;286(5439):498-502.|||Science. 1999 Oct 15;286(5439):498-502||Skeate et al., 2020|||Science. 1999 Oct 15;286(5439):498-502.J Leukoc Biol. 2001 Sep;70(3):461-464.J Biol Chem. 2002 Feb 1;277(5):3079-3084.|||Science. 1999 Oct 15;286(5439):498-502|||Science. 1999 Oct 15;286(5439):498-502. 18 FPDB00047 AP00451|||AP00451|||HBD1|||DRAMP02722 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK Anti-Gram+ & Gram-||Antiviral||Antifungal||candidacidal||Anti-HIV||Anti-toxin||Channel inhibitors||Synergistic AMPs||Anticancer||While the reduced form is active against both Gram+ and Gram- bacteria||the oxidized form is only active against Gram- bacteria with little effect on cell envelope . Interestingly||it inhibits the growth of clinical S. aureus strains but NOT lab strains. It was observed that hBD-1 from human platelets can cluster bacteria and signals NETs formation .||Antimicrobial||Antibacterial airway, hemofiltrates, urine, kidney; keratinocytes; skin; platelets; oral saliva; milk, mammary gland epithelium, colonic mucosa, Homo sapiens|||airway, hemofiltrates, urine, kidney; keratinocytes; skin; platelets; oral saliva; milk, mammary gland epithelium, colonic mucosa, Homo sapiens|||Synthetic construct Combine Helix and Beta structure Moderate hemolytic activity (50% hemolysis at 50 µM) "FEBS Lett. 1995 Jul 17;368(2):331-5. PubMed|||Bensch KW, Raida M, Mägert HJ, Schulz-Knappe P, Forssmann WG.1995 FEBS Lett. 1995 Jul 17;368(2):331-5. PubMed||Raschig J et al., 2017||Kraemer BF et al. 2011 PLoS Pathog Nov 7|||1995 Jul 17;368(2):331-5. doi: 10.1016/0014-5793(95)00687-5.||Raschig J et al., 2017||Kraemer BF et al. 2011 PLoS Pathog Nov 7|||FEBS Lett. 1995 Jul 17;368(2):331-5. doi: 10.1016/0014-5793(95)00687-5.||Raschig J et al., 2017||Kraemer BF et al. 2011 PLoS Pathog Nov 7|||FEBS Lett . 1995 Jul 17;368(2):331-5. doi: 10.1016/0014-5793(95)00687-5.||Raschig J et al., 2017||Kraemer BF et al. 2011 PLoS Pathog Nov 7|||FEBS Lett. 1995 Jul 17;368(2):331-5. PubMed||Raschig J et al., 2017||Kraemer BF et al. 2011 PLoS Pathog Nov 7|||Pongo pygmaeus (Bornean orangutan)||Immunogenetics. 2002 Feb;53(10-11):907-913.Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases.|||FEBS Lett. 1995 Jul 17;368(2):331-5. PubMed" 36 FPDB00053 AP00524|||AP00524|||HBD2|||Human beta-defensin-2 WT hBD - 2|||AP00524|||DRAMP03598 " GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP" Anti-Gram+ & Gram-||Antiviral||Antifungal||candidacidal||Anti-HIV||Chemotactic||Anti-toxin||Channel inhibitors||Synergistic AMPs||Antibiofilm||Wound healing||Anti-synthetic: Active against E. coli DSM1103, activity value is MIC = 18.8 ug/ml||Anti-K. pneumoniae DSM681, activity value is MIC = 37.5 ug/ml||Anti-P. aeruginosa DSM1128, activity value is MIC = 25 ug/ml||Anti-S. aureus ATCC25923, activity value is MIC = 100 ug/ml||Anti-and S.pneumoniae DSM11865, activity value is MIC = 300 ug/ml||Antibacterial||Antimicrobial||Anti-Gram+||Anti-Gram- airway, skin, lung, trachea epithelia, and uterus, oral (saliva); Homo sapiens|||airway, skin, lung, trachea epithelia, and uterus, oral (saliva); Homo sapiens|||Synthetic construct|||Homo sapiens [Human]|||airway, skin, lung, trachea epithelia, and uterus, oral (saliva); Homo sapiens|||Homo sapiens (Human) Combine Helix and Beta structure [Ref.15625724] It is slightly hemolytic (<12%) against human erythrocytes at the highest concentration of 500 ug/ml. "Nature. 1997 Jun 26;387(6636):861. PubMed.|||1997 Jun 26;387(6636):861. doi: 10.1038/43088.||see ref AP1315|||Nature. 1997 Jun 26;387(6636):861. doi: 10.1038/43088.|||Nature . 1997 Jun 26;387(6636):861. doi: 10.1038/43088.||see ref AP1315|||9727055|||Nature. 1997 Jun 26;387(6636):861. PubMed.|||Nature. 1997 Jun 26;387(6636):861.J Biol Chem. 2000 Oct 20;275(42):32911-32918.Plant Cell Rep. 2007 Aug;26(8):1391-1398." 41 FPDB00062 AP00724|||AP00724|||RTD-2|||DRAMP31352|||AP00724|||DRAMP31352 " GVCRCLCRRGVCRCLCRR" Anti-Gram+ & Gram-||Antiviral||Antifungal||candidacidal||Anti-HIV||Anti-toxin||Antibacterial||Antimicrobial Bone marrow, or blood leukocytes, rhesus monkey, Macaca mulatta|||Bone marrow, or blood leukocytes, rhesus monkey, Macaca mulatta|||Macaca mulatta [Rhesus macaque]|||Macaca mulatta (Rhesus macaque)|||Bone marrow, or blood leukocytes, rhesus monkey, Macaca mulatta|||Macaca mulatta (Rhesus macaque) Bridge Strong hemolytic activity (100% hemolysis at 5 μM) J Leukoc Biol 2001; 70:461-464|||J Leukoc Biol 2001; 70:461-464|||11675394|||J Immunol. 2004 Jul 1;173(1):515-20.|||J Leukoc Biol 2001; 70:461-464|||J Immunol. 2004 Jul 1;173(1):515-20. 18 FPDB00063 AP00725|||AP00725|||Rhesus theta defensin-1/3, subunit A precursor|||DRAMP31353|||AP00725|||Rhesus theta defensin-1/3, subunit A precursor|||DRAMP31353 " GFCRCICTRGFCRCICTR" Anti-Gram+ & Gram-||Antiviral||Antifungal||candidacidal||Anti-HIV||Anti-toxin||Antibacterial||Antimicrobial||Antiviral ; Staphylococcus aureus 502a||Escherichia coli ML35||and yeast forms of Candida albicans 16820 and Cryptococcus neoformans 271A||HIV Bone marrow, or blood leukocytes, rhesus monkey, Macaca mulatta|||Bone marrow, or blood leukocytes, rhesus monkey, Macaca mulatta|||Macaca mulatta [Rhesus macaque]|||Macaca mulatta (Rhesus macaque)|||Bone marrow, or blood leukocytes, rhesus monkey, Macaca mulatta|||Macaca mulatta [Rhesus macaque]|||Macaca mulatta (Rhesus macaque) Bridge Strong hemolytic activity (100% hemolysis at 5 μM) J Leukoc Biol 2001; 70:461-464|||J Leukoc Biol 2001; 70:461-464|||11675394|||J Immunol. 2004 Jul 1;173(1):515-20.|||J Leukoc Biol 2001; 70:461-464|||https://pubmed.ncbi.nlm.nih.gov/11675394|||J Immunol. 2004 Jul 1;173(1):515-20. 18 FPDB00088 AP01207|||AP01207|||Retrocyclin-1 GICRCICGRGICRCICGR Antiviral||Anti-HIV||Anti-toxin||Antiviral ; HIV-1 mammal theta-defensin; Derived from a silent human gene (pre-stop), animal-derived, natural derivative|||mammal theta-defensin; Derived from a silent human gene (pre-stop), animal-derived, natural derivative|||Synthetic construct Bridge N/A Proc Natl Acad Sci U S A. 2002 Feb 19;99(4):1813-8|||Proc Natl Acad Sci U S A. 2002 Feb 19;99(4):1813-8|||https://pubmed.ncbi.nlm.nih.gov/15210812 18 FPDB00089 AP01208|||AP01208|||Retrocyclin-2 " GICRCICGRRICRCICGR" Antiviral||Anti-HIV||Anti-toxin||RC2 is most active against primary isolates of HIV-1. The molecule can self associate in water in a concentration dependent manner.||Antiviral ; HIV-1 mammal theta-defensin; Derived from a silent human gene (pre-stop), animal-derived, natural derivative|||mammal theta-defensin; Derived from a silent human gene (pre-stop), animal-derived, natural derivative|||Synthetic construct Beta N/A J Immunol. 2004 Jul 1;173(1):515-20|||J Immunol. 2004 Jul 1;173(1):515-20|||https://pubmed.ncbi.nlm.nih.gov/15210812 18 FPDB00098 AP01672|||AP01627|||AP01672|||RC-101 " GICRCICGKGICRCICGR" Anti-Gram+||Antiviral||Anti-HIV||Anti-MRSA||Anti-toxin||Antibiofilm||inhibit S. aureus USA300||viruses HIV-1||SARS-Cov-2||influenza.||Antibacterial amino acid substitution, mammal theta-defensin analog, animal-derived, natural derivative|||amino acid substitution, mammal theta-defensin analog, animal-derived, natural derivative|||Synthetic construct Bridge N/A "RC-101, a retrocyclin-1 analogue with enhanced activity against primary HIV type 1 isolates. PubMed.|||2004 Nov;20(11):1157-65. doi: 10.1089/aid.2004.20.1157.||Lamers et al., 2011|||AIDS Res Hum Retroviruses.2004 Nov;20(11):1157-65. doi: 10.1089/aid.2004.20.1157.||Lamers et al., 2011|||AIDS Res Hum Retroviruses . 2004 Nov;20(11):1157-65. doi: 10.1089/aid.2004.20.1157.|||AIDS Res Hum Retroviruses . 2004 Nov;20(11):1157-65. doi: 10.1089/aid.2004.20.1157.|||16790431" 18 FPDB00884 AP00180|||DRAMP03595|||Human Defensin-5|||AP00180|||DRAMP03595|||AP00180|||DRAMP03595|||Human Defensin-5 ATCYCRTGRCATRESLSGVCEISGRLYRLCCR "Anti-Gram+ & Gram-||Antiviral||Antifungal||Anti-toxin||anti-sepsis||Wound healing||Killed C. difficile. Human HD5 blocks papillomavirus infection (both cutaneous and mucosal papillomavirus types). HD-5 was particularly active against sexually transmitted HPV types . HD-5 is active against pseudotyped viruses expressing SARS-CoV-2 spike proteins . It also results in decreased bacterial presence||enhanced wound healing||and hair growth from tissues devoid of adnexal structures (Lough D||et al.||2013). It also neutralizes Clostridioides difficile Toxins TcdA||TcdB||and CDT .||Killed C. difficile. Human HD5 blocks papillomavirus infection (both cutaneous and mucosal papillomavirus types). HD-5 was particularly active against sexually transmitted HPV types . HD-5 is active against pseudotyped viruses expressing SARS-CoV-2 spike proteins .||Antimicrobial||Antibacterial||Anti-Gram+||Anti-Gram-||Antiviral(SARS-CoV-2)||Antiviral(SARS-CoV-5)||Antiviral ; E. coli ATCC 25922 ( IC99 = 49.5 +/- 0.2 ug/ml)||S. aureus ATCC 29123 ( IC99 = 6.3 +/- 1.8 ug/ml)||C. albicans ATCC 99788 amphotericin B resistant ( IC90 > 100 ug/ml )||Adenovirus||Refer PubMed ID: A. baumannii 4-MRGN||K. pneumoniae 4-MRGN||P. aeruginosa ATCC27853||E. faecium 475747||B. longum||L. fermentum||L. salivarius||S. salivarius salivarius||Akkermansia muciniphila||B. subtilis 168trpC||S. aureus USA300||B. adolescentis Ni3.29c||B. breve||B. vulgatus DSM1447||L. rhamnosus||E. coli MC1000" Paneth cells, intestine, urinary tract, Homo sapiens|||Homo sapiens (Human)|||Homo sapiens [Human]|||Paneth cells, intestine, urinary tract, Homo sapiens|||Homo sapiens (Human)|||Paneth cells, intestine, urinary tract, Homo sapiens|||Homo sapiens (Human)|||Homo sapiens Beta||Beta strand [Ref.26206286] It has 0% hemolysis at 100 uM against human red blood cells. J. Biol. Chem. 1992; 267:23216-23225|||J. Biol. Chem. 1992; 267:23216-23225||Buck et al., 2006||Xu et al., 2021||Korbmacher et al. 2020|||Buck et al., 2006||Xu et al., 2021|||Viruses. 2021 Jun 26;13(7):1246.|||18191790 , 17088326, 30808760|||J. Biol. Chem. 1992; 267:23216-23225||Buck et al., 2006||Xu et al., 2021|||Viruses. 2021 Jun 26;13(7):1246.Nat Immunol. 2002 Jun;3(6):583-590.Antimicrob Agents Chemother. 2005 Jan;49(1):269-275.Peptides. 2015 Sep;71:128-40. doi: 10.1016/j.peptides.2015.07.009. Epub 2015 Jul 20.|||J. Biol. Chem. 1992; 267:23216-23225||Buck et al., 2006||Xu et al., 2021|||Viruses. 2021 Jun 26;13(7):1246.|||https://pubmed.ncbi.nlm.nih.gov/18191790 32 FPDB00885 AP00675 EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP Active against E. coli ATCC 25922||E. faecalis. skin, Homo sapiens|||skin, Homo sapiens Beta N/A "2001 Aug;15(10):1819-21.|||FASEB J . 2001 Aug;15(10):1819-21." 50 FPDB00886 AP00707|||AP00707|||A3-APO|||Chex1Arg20|||Peptide 1|||DRAMP04224 RPDKPRPYLPRPRPPRPVR Active against Gram-negative bacteria. It also prevents B. anthracis mortality by deactivating bacterial toxins .||Anti-Escherichia coli, activity value is MIC = 2||Anti-Klebsiella pneumoniae, activity value is MIC = 4||Anti-Salmonella enterica serovar Typhimurium strains, activity value is MIC = 8||Anti-Pseudomonas aeruginosa, activity value is MIC = 4||Anti-E. coli BW25113, activity value is MIC = 4 ug/ml||Anti-E. coli MC4100, activity value is MIC = 4 ug/ml||Anti-E. coli ATCC 25922, activity value is MIC = 8 ug/ml||Anti-K. pneumoniae ATCC 10031, activity value is MIC = 4 ug/ml||Anti-P. aeruginosa ATCC 27853, activity value is MIC = 64 ug/ml||Anti-Salmonella typhimurium, activity value is MIC = 32 uM||Antibacterial ; Synthetic construct||Anti-E. coli BW25113, activity value is MIC = 8 ug/ml||Antimicrobial||Antibacterial engineered|||engineered|||Synthetic construct|||Synthetic construct nonHelixbeta E. coli BW25113 (MIC= 8 ug/ml), S. aureus DSM 6247 (MIC= >128 ug/ml) Int J Antimicrob Agents. 2010 Apr;35(4):357-61||Otvos et al., 2014|||Int J Antimicrob Agents. 2010 Apr;35(4):357-61.||Otvos et al., 2014|||20031377|||29309652|||29051620|||https://pubmed.ncbi.nlm.nih.gov/35223768|||Int J Antimicrob Agents. 2010 Apr;35(4):357-361. 19 FPDB00887 AP01209|||AP01209|||Retrocyclin-3 RICRCICGRRICRCICGR "Antiviral||Anti-toxin Crucial residues:||Anti-toxin||Antiviral ; HIV-2" mammal theta-defensin; Derived from a silent human gene (pre-stop), animal-derived, natural derivative|||mammal theta-defensin; Derived from a silent human gene (pre-stop), animal-derived, natural derivative|||Synthetic construct Bridge N/A J Immunol. 2004 Jul 1;173(1):515-20|||J Immunol. 2004 Jul 1;173(1):515-20|||https://pubmed.ncbi.nlm.nih.gov/15210812 18